Toll Free Phone: 1-866-892-2032
[email protected]
Servicing Healthcare Professionals and Companies
We Accept:
Never Overpay Again    |   5% First Order Discount   |   No Order Minimum   |   Free Replacement on Delays
Free Shipping After: $1000
OUR PRODUCTS
OUR BRANDS
Cag+Sem 10mg Front
Cag+Sem 10mg Back
NOVERA COMPOUNDS

Cagrilintide 5mg + Semaglutide 5mg

All products are 100% genuine and sourced from trusted manufacturers, with authenticity that can be verified for complete peace of mind.

Order exactly what you need with no minimum quantity required, whether it’s a single unit or a larger order.

Your order is guaranteed to arrive safely, with full shipment tracking and dedicated support to ensure a smooth delivery experience.

Your payments are protected with industry-standard encryption and trusted payment providers, ensuring every transaction is safe, private, and secure.

99% PURITY GUARANTEE

Each peptide batch is tested and verified to meet or exceed 98–99% purity (HPLC). Full analytical reports are available in the Certificate of Analysis section.

Preparation & Handling Notice

The product is delivered in powdered (lyophilized) form and must be properly reconstituted prior to research use.

RESEARCH USE ONLY

This product is intended for research use only. It is not for human or veterinary use, not for diagnostic or therapeutic purposes, and should only be handled by qualified professionals.

Strength: 10mg
CAS: Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2
Chemical Formula: Cagrilintide: C₁₉₄H₃₁₂N₅₄₀₅₉₅S₂ Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉
Molecular weight: Cagrilintide:4409 g/mol Semaglutide: 4114 g/mol
Peptide Sequence: Cagrilintide: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Semaglutide: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH
Synonyms: CagriSema
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.

Cagrilintide + Semaglutide is a fixed dose combination of a long acting amylin analogue and a GLP 1 receptor agonist, studied as ‘CagriSema’ in adults with overweight or obesity, with and without type 2 diabetes. Clinical trials have evaluated changes in body weight, energy intake, and glycemic measures with this combination compared with cagrilintide alone, semaglutide alone, or placebo. Gastrointestinal side effects have generally been consistent with those of incretin based therapies. However, it remains an investigational regimen and is not an approved treatment.

  • Cold chain shipping available for temperature-sensitive products.

  • Orders are processed within 1–2 business days.

  • Delivery timelines vary by destination and shipping method — view our Shipping Policy for region-specific estimates.

  • Tracking information will be provided once shipped.

  • No order minimum applies.

  • If your shipment is delayed, lost, or arrives damaged, you're covered under our Refund & Replacement Policy.

We accept Visa, Mastercard, and American Express. Apple Pay and Google Pay are available upon request via your account manager.

All transactions are processed through a secure, PCI DSS–compliant system to ensure your data is fully protected.

Why Choose NOVERA COMPOUNDS Peptides?

Novera Research delivers high-quality research peptides developed under strict manufacturing and quality-control standards. Each product is carefully synthesized, tested, and handled to ensure consistency, reliability, and transparency for advanced research applications.

  • High-purity, research-grade peptide synthesis
  • Analytical testing to verify quality and composition
  • Consistent batch-to-batch performance
  • Batch identification on every vial for traceability
  • Stored and shipped under controlled conditions
Why Choose Medica Depot Why Choose Medica Depot

Why Choose Medica Depot

Shop hundreds of medical products with no minimums and free shipping on large orders.

400+ products 400+ products
No order minimums No order minimums
Free shipping Free shipping
Loyalty rewards Loyalty rewards
Trusted since 2007 Trusted since 2007
Account manager Account manager
Verified LOT numbers Verified LOT numbers
Browse Products

INFORMATION

What is Cagrilintide 5mg + Semaglutide 5mg?

Cagrilintide 5mg + Semaglutide 5mg is a fixed-combination research material in the peptides category, within the weight loss and metabolic peptides subcategory. It contains two long-acting peptide analogues: cagrilintide, a synthetic amylin receptor agonist, and semaglutide, a glucagon-like peptide-1 (GLP-1) receptor agonist.

Researchers often call this investigational pairing “CagriSema.” Studies have examined it for effects on appetite, energy intake, body weight, and metabolic control in adults with overweight or obesity, including some populations with type 2 diabetes.

Cagrilintide is a 39–amino-acid amylin analogue, while semaglutide is a 31–amino-acid GLP-1 analogue. Both peptides include acylation that supports longer activity through albumin binding. The 5 mg + 5 mg format supports controlled experiments that look at combined amylin and GLP-1 signaling from a single preparation.

Product Specifications

  • Components and CAS Numbers:
    • Cagrilintide: CAS 1415456‑99‑3​
    • Semaglutide: CAS 910463‑68‑2
  • Molecular Weights:
    • Cagrilintide: 4409 g/mol
    • Semaglutide: 4113.6 g/mol (approx.)
  • Chemical Formulas:
    • Cagrilintide: C₁₉₄H₃₁₂N₅₄O₅₉S₂
    • Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉
  • Purity: Typically supplied as high‑purity peptides (often ≥98% by HPLC) with identity confirmed by mass spectrometry; exact purity and analytical data are reported on the Certificate of Analysis for each lot.
  • Packaging Format: 1 vial containing a total of 10 mg peptide, composed of 5 mg cagrilintide and 5 mg semaglutide as a lyophilized (freeze‑dried) powder in a sealed research‑use vial.
  • Storage Conditions: Store at −20°C or below, protected from light and moisture; avoid repeated freeze–thaw cycles.
  • Intended Use: For Laboratory Research Use Only (not for human or veterinary use).

Key Characteristics of Cagrilintide 5mg + Semaglutide 5mg

  • Dual-Pathway Peptide Combination: Combines amylin-pathway activation (cagrilintide) with GLP-1 receptor activation (semaglutide) to study two key gut–brain hormone systems involved in satiety and metabolic regulation.
  • Investigational Fixed-Dose Format: The CagriSema combination has been evaluated as a once-weekly investigational regimen in phase 2 and phase 3 studies in adults with overweight or obesity, with and without type 2 diabetes. The 5mg + 5mg vial is a research-scale presentation aligned with this dual-component concept.
  • Long Half-Life of Both Components: Both components are acylated peptides with multi-day half-lives in humans, enabling research on sustained receptor signaling in relevant models.
  • High-Purity, Analytical-Grade Peptides: Supplied as high-purity (>98%) research-grade materials, with HPLC and LC-MS data on the CoA, suitable for in vitro experiments, in vivo model work, and ex vivo mechanistic studies.
  • Lyophilized for Stability: Freeze-drying helps preserve peptide integrity during transport and long-term storage. When stored at −20°C or below and protected from light, both components maintain stability for extended periods under recommended conditions.
  • Versatile Across Experimental Designs: Researchers use the combination in protocols that track outcomes such as body weight, energy intake, glycemic measures, blood pressure, and other cardiometabolic markers (model-dependent).
  • Informed by Robust Clinical Literature: Phase 1b, phase 2, and phase 3a programs have generated substantial data in obesity and type 2 diabetes research populations, helping guide mechanistic and translational study design.

How Cagrilintide 5mg + Semaglutide 5mg Supports Research

Researchers use this combination to study how simultaneous amylin and GLP-1 pathway activation influences appetite, energy intake, body weight, and metabolic markers. By pairing two long-acting peptides, investigators can compare combined signaling with each component alone and assess whether the time course or magnitude of effects differs under controlled conditions.

Clinical studies of CagriSema have measured endpoints such as body weight change, glycemic measures, and cardiometabolic risk markers in adults with overweight/obesity (including some with type 2 diabetes).

These findings help researchers plan preclinical and translational work on integrated gut–brain hormone signaling, receptor interactions, and downstream pathways tied to weight and glucose regulation.

Research Applications & Usage Information

Cagrilintide 5mg + Semaglutide 5mg is commonly used in various research studies related to body weight regulation, metabolism, and receptor signaling. Typical applications include:

  • Obesity and Weight-Management Models: Evaluating how dual amylin + GLP-1 signaling influences body weight, waist measures, and energy intake in animal models and clinical research settings.
  • Type 2 Diabetes and Metabolic Syndrome Studies: Examining changes in HbA1c, fasting glucose, insulin-related measures, and other metabolic readouts in research populations with excess weight.
  • Gut–Brain Axis and Appetite Signaling: Studying how peripheral hormones influence CNS circuits involved in hunger, satiety, food choice, and reward-related feeding behavior.
  • Comparative and Combination-Therapy Evaluations: Comparing the combination versus cagrilintide alone, semaglutide alone, and placebo to clarify additive or distinct effects within the study design.
  • Pharmacokinetics and Pharmacodynamics (PK/PD): Assessing exposure over time, half-life, exposure–response relationships, and alignment of PK properties when studied together.
  • Cardiometabolic Risk Factor Research: Monitoring blood pressure, lipids, cardiovascular risk markers, and liver-related parameters in broader metabolic protocols.

This combination is not intended for tissue regeneration or therapeutic use; it is a research tool used to understand biological mechanisms and outcomes under controlled experimental conditions. Any observed clinical changes in trials are specific to those study designs and should not be generalized as established therapeutic effects outside a regulated research context.

Handling and Storage Recommendations

Proper handling and storage are important to preserve the quality of both peptide components:

  • Keep sealed vials at −20 °C, dry, and protected from light; use secondary packaging when possible.
  • Let the sealed vial reach room temperature to reduce condensation.
  • Store 2-8 °C (short-term) or −20 °C (long-term) per validated stability/institutional practice. Discard if cloudy, discolored, or particulate.
  • Wear standard PPE and dispose of materials per institutional chemical/biohazard waste rules.

Research Use Only Notice

This product is intended for laboratory research use only and is not approved for human or veterinary use. It is not intended for diagnostic, therapeutic, or clinical applications. Any reference to biological activity or potential effects is based solely on preclinical or in-vitro findings and should not be interpreted as validated clinical outcomes. Researchers are responsible for ensuring proper handling, storage, and disposal in accordance with institutional, federal, and international guidelines.

References

  1. Frias JP, Deenadayalan S, Erichsen L, et al. Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet. 2023;402(10403):720-730. doi:10.1016/S0140-6736(23)01163-7
  2. Davies MJ, Bajaj HS, Broholm C, et al. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. N Engl J Med. 2025;393(7):648-659. doi:10.1056/NEJMoa2502082
  3. Verma S, Böttcher M, Brown P, et al. CagriSema Reduces Blood Pressure in Adults With Overweight or Obesity: REDEFINE 1. Hypertension. 2026;83(2):e26055. doi:10.1161/HYPERTENSIONAHA.125.26055
  4. Garvey WT, Blüher M, Osorto Contreras CK, et al. Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. N Engl J Med. 2025;393(7):635-647. doi:10.1056/NEJMoa2502081
  5. Enebo LB, Berthelsen KK, Kankam M, et al. Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2·4 mg for weight management: a randomised, controlled, phase 1b trial. Lancet. 2021;397(10286):1736-1748. doi:10.1016/S0140-6736(21)00845-X

What is Cagrilintide 5mg + Semaglutide 5mg?

Cagrilintide 5mg + Semaglutide 5mg is a fixed-combination research material in the peptides category, within the weight loss and metabolic peptides subcategory. It contains two long-acting peptide analogues: cagrilintide, a synthetic amylin receptor agonist, and semaglutide, a glucagon-like peptide-1 (GLP-1) receptor agonist.

Researchers often call this investigational pairing “CagriSema.” Studies have examined it for effects on appetite, energy intake, body weight, and metabolic control in adults with overweight or obesity, including some populations with type 2 diabetes.

Cagrilintide is a 39–amino-acid amylin analogue, while semaglutide is a 31–amino-acid GLP-1 analogue. Both peptides include acylation that supports longer activity through albumin binding. The 5 mg + 5 mg format supports controlled experiments that look at combined amylin and GLP-1 signaling from a single preparation.

Product Specifications

  • Components and CAS Numbers:
    • Cagrilintide: CAS 1415456‑99‑3​
    • Semaglutide: CAS 910463‑68‑2
  • Molecular Weights:
    • Cagrilintide: 4409 g/mol
    • Semaglutide: 4113.6 g/mol (approx.)
  • Chemical Formulas:
    • Cagrilintide: C₁₉₄H₃₁₂N₅₄O₅₉S₂
    • Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉
  • Purity: Typically supplied as high‑purity peptides (often ≥98% by HPLC) with identity confirmed by mass spectrometry; exact purity and analytical data are reported on the Certificate of Analysis for each lot.
  • Packaging Format: 1 vial containing a total of 10 mg peptide, composed of 5 mg cagrilintide and 5 mg semaglutide as a lyophilized (freeze‑dried) powder in a sealed research‑use vial.
  • Storage Conditions: Store at −20°C or below, protected from light and moisture; avoid repeated freeze–thaw cycles.
  • Intended Use: For Laboratory Research Use Only (not for human or veterinary use).

Key Characteristics of Cagrilintide 5mg + Semaglutide 5mg

  • Dual-Pathway Peptide Combination: Combines amylin-pathway activation (cagrilintide) with GLP-1 receptor activation (semaglutide) to study two key gut–brain hormone systems involved in satiety and metabolic regulation.
  • Investigational Fixed-Dose Format: The CagriSema combination has been evaluated as a once-weekly investigational regimen in phase 2 and phase 3 studies in adults with overweight or obesity, with and without type 2 diabetes. The 5mg + 5mg vial is a research-scale presentation aligned with this dual-component concept.
  • Long Half-Life of Both Components: Both components are acylated peptides with multi-day half-lives in humans, enabling research on sustained receptor signaling in relevant models.
  • High-Purity, Analytical-Grade Peptides: Supplied as high-purity (>98%) research-grade materials, with HPLC and LC-MS data on the CoA, suitable for in vitro experiments, in vivo model work, and ex vivo mechanistic studies.
  • Lyophilized for Stability: Freeze-drying helps preserve peptide integrity during transport and long-term storage. When stored at −20°C or below and protected from light, both components maintain stability for extended periods under recommended conditions.
  • Versatile Across Experimental Designs: Researchers use the combination in protocols that track outcomes such as body weight, energy intake, glycemic measures, blood pressure, and other cardiometabolic markers (model-dependent).
  • Informed by Robust Clinical Literature: Phase 1b, phase 2, and phase 3a programs have generated substantial data in obesity and type 2 diabetes research populations, helping guide mechanistic and translational study design.

How Cagrilintide 5mg + Semaglutide 5mg Supports Research

Researchers use this combination to study how simultaneous amylin and GLP-1 pathway activation influences appetite, energy intake, body weight, and metabolic markers. By pairing two long-acting peptides, investigators can compare combined signaling with each component alone and assess whether the time course or magnitude of effects differs under controlled conditions.

Clinical studies of CagriSema have measured endpoints such as body weight change, glycemic measures, and cardiometabolic risk markers in adults with overweight/obesity (including some with type 2 diabetes).

These findings help researchers plan preclinical and translational work on integrated gut–brain hormone signaling, receptor interactions, and downstream pathways tied to weight and glucose regulation.

Research Applications & Usage Information

Cagrilintide 5mg + Semaglutide 5mg is commonly used in various research studies related to body weight regulation, metabolism, and receptor signaling. Typical applications include:

  • Obesity and Weight-Management Models: Evaluating how dual amylin + GLP-1 signaling influences body weight, waist measures, and energy intake in animal models and clinical research settings.
  • Type 2 Diabetes and Metabolic Syndrome Studies: Examining changes in HbA1c, fasting glucose, insulin-related measures, and other metabolic readouts in research populations with excess weight.
  • Gut–Brain Axis and Appetite Signaling: Studying how peripheral hormones influence CNS circuits involved in hunger, satiety, food choice, and reward-related feeding behavior.
  • Comparative and Combination-Therapy Evaluations: Comparing the combination versus cagrilintide alone, semaglutide alone, and placebo to clarify additive or distinct effects within the study design.
  • Pharmacokinetics and Pharmacodynamics (PK/PD): Assessing exposure over time, half-life, exposure–response relationships, and alignment of PK properties when studied together.
  • Cardiometabolic Risk Factor Research: Monitoring blood pressure, lipids, cardiovascular risk markers, and liver-related parameters in broader metabolic protocols.

This combination is not intended for tissue regeneration or therapeutic use; it is a research tool used to understand biological mechanisms and outcomes under controlled experimental conditions. Any observed clinical changes in trials are specific to those study designs and should not be generalized as established therapeutic effects outside a regulated research context.

Handling and Storage Recommendations

Proper handling and storage are important to preserve the quality of both peptide components:

  • Keep sealed vials at −20 °C, dry, and protected from light; use secondary packaging when possible.
  • Let the sealed vial reach room temperature to reduce condensation.
  • Store 2-8 °C (short-term) or −20 °C (long-term) per validated stability/institutional practice. Discard if cloudy, discolored, or particulate.
  • Wear standard PPE and dispose of materials per institutional chemical/biohazard waste rules.

Research Use Only Notice

This product is intended for laboratory research use only and is not approved for human or veterinary use. It is not intended for diagnostic, therapeutic, or clinical applications. Any reference to biological activity or potential effects is based solely on preclinical or in-vitro findings and should not be interpreted as validated clinical outcomes. Researchers are responsible for ensuring proper handling, storage, and disposal in accordance with institutional, federal, and international guidelines.

References

  1. Frias JP, Deenadayalan S, Erichsen L, et al. Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet. 2023;402(10403):720-730. doi:10.1016/S0140-6736(23)01163-7
  2. Davies MJ, Bajaj HS, Broholm C, et al. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. N Engl J Med. 2025;393(7):648-659. doi:10.1056/NEJMoa2502082
  3. Verma S, Böttcher M, Brown P, et al. CagriSema Reduces Blood Pressure in Adults With Overweight or Obesity: REDEFINE 1. Hypertension. 2026;83(2):e26055. doi:10.1161/HYPERTENSIONAHA.125.26055
  4. Garvey WT, Blüher M, Osorto Contreras CK, et al. Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. N Engl J Med. 2025;393(7):635-647. doi:10.1056/NEJMoa2502081
  5. Enebo LB, Berthelsen KK, Kankam M, et al. Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2·4 mg for weight management: a randomised, controlled, phase 1b trial. Lancet. 2021;397(10286):1736-1748. doi:10.1016/S0140-6736(21)00845-X
CART (0)

No products in the cart.